LOCUS       SEQPYGHL2B   1589 bp    mRNA            VRT       02-JUN-1999
DEFINITION  Seriola quinqueradiata GHL2 mRNA for YGHL2, complete cds.
ACCESSION   D85881
NID         g4972325
VERSION     D85881.2  GI:4972325
KEYWORDS    YGHL2; GHL2.
SOURCE      Seriola quinqueradiata pituitary gland cDNA to mRNA,
            clone_lib:lambda gt11 clone:pYGHL2.
  ORGANISM  Seriola quinqueradiata
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii;
            Neopterygii; Teleostei; Euteleostei; Acanthopterygii; Percomorpha;
            Perciformes; Carangoidei; Carangidae; Seriola.
REFERENCE   1  (bases 1 to 1586)
  AUTHORS   Azama,K., Kirito,Y., Tsujimura,Y. and Abe,s.
  TITLE     S.quinqueradiata pYGL-2 mRNA,complete cds
  JOURNAL   Unpublished (1995)
REFERENCE   2  (bases 1 to 1589)
  AUTHORS   Abe,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUN-1996) to the DDBJ/EMBL/GenBank databases.
            Shunnosuke Abe, University of Ehime, Department of Biological
            Resources; 3-5-7 Tarumi, Matsuyama, Ehime 790-8566, Japan
            (E-mail:abe@dpc.ehime-u.ac.jp, Tel:81-899-46-9853,
            Fax:81-899-46-9853)
COMMENT     On Jun 2, 1999 this sequence version replaced gi:1408060.
            Sequence updated (16-Jul-1996)
            Sequence updated (27-May-1999).
FEATURES             Location/Qualifiers
     source          1..1589
                     /organism="Seriola quinqueradiata"
                     /db_xref="taxon:8161"
                     /clone="pYGHL2"
                     /clone_lib="lambda gt11"
                     /tissue_type="pituitary gland"
     gene            3..1181
                     /gene="GHL2"
     CDS             <3..1181
                     /gene="GHL2"
                     /codon_start=1
                     /product="YGHL2"
                     /protein_id="BAA12906.2"
                     /db_xref="PID:d1041881"
                     /db_xref="PID:g4972326"
                     /db_xref="GI:4972326"
                     /translation="TKQVTCRYFLHGVCREGSRCLFSHDLNNSKPSTICKFYQRGVCA
                     YGERCRYDHIKPSSRGGGGGAPEDQAGGGGAGGGGAGIGGAGGGPSVRGGMKKNLVLR
                     DRVLGVDRVDRMFGAPADSMWSDVSTAAAPHSYVEAIRTGLDASAQDQATPPVCGPSQ
                     NLPQLCPYAANGHCFYEENCTYLHGDLCEVCGLQVLHPHDSEQRRAHEKMCLAAFEAD
                     MEKAFAAQLSQDKVCSICMEVVVQKANPSDRRFGILSSCCHTFCLACIRKWRCTRTFS
                     NTIIKSCPECRVVSEFVIPSVYWVEDQEDKDHLIDLFKSGVSKKACKYFDQGRGSCPF
                     GGKCLYLHAFPDGTRAEPDRPRKQLSSEGNVRFMNNVRLWDFIEEREQRSVPPLAGPR
                     "
     polyA_site      1586
BASE COUNT      359 a    391 c    464 g    375 t
ORIGIN      
        1 gcaccaaaca ggtgacctgc aggtattttc tccacggtgt gtgcagagag ggcagccgct
       61 gtctgttctc tcacgacctg aacaacagta aaccctcaac catctgcaag ttctaccaga
      121 gaggagtgtg tgcttatgga gaacgctgca ggtatgacca catcaaacct tcatcaagag
      181 gtggaggggg aggagctcca gaggatcagg caggtggagg gggtgctggc ggcgggggag
      241 ctggcatcgg gggagctggc ggcgggcctt cagtcagagg tggaatgaag aagaacctgg
      301 tcctgagaga tagagttcta ggtgtagaca gggtagacag gatgttcggg gctccagcag
      361 acagtatgtg gtcagatgtc tcaacagctg cagctcctca ctcctatgtg gaagccatca
      421 ggacgggcct ggacgcttca gcgcaggatc aagccactcc cccagtgtgt gggccttccc
      481 agaacctccc ccagctgtgc ccctatgctg ccaatggaca ctgtttctat gaagaaaact
      541 gtacctatct ccatggcgac ctgtgtgagg tgtgcgggct gcaggtgctc catccccacg
      601 actccgagca gaggagagcg catgagaaga tgtgtctggc ggcctttgag gccgacatgg
      661 agaaggcgtt tgctgcgcag ctcagccagg acaaggtgtg ttccatctgt atggaggtgg
      721 tggtgcagaa ggcaaaccca tcggaccgca ggttcggcat tctgtcgtcc tgctgtcaca
      781 ccttctgtct ggcctgcatc agaaagtggc gctgcaccag aaccttcagc aacacgatca
      841 ttaagtcgtg tccggagtgt cgggtcgtct cagagtttgt catcccctca gtttactggg
      901 tggaggatca ggaggacaag gaccacctca tagacctctt caagtctgga gtcagtaaga
      961 aggcctgtaa gtacttcgat caaggacgcg gttcgtgtcc gtttggaggg aagtgtttgt
     1021 accttcacgc cttcccagac ggaacccgag cagaacccga ccggccacgg aaacaactga
     1081 gctccgaggg caacgtccgg ttcatgaaca acgtccgtct gtgggacttc atcgaggagc
     1141 gcgagcagcg gtcggtcccg cccctggccg gccctcgatg atgacatggc agagctgagg
     1201 gagctcttca tgcagatgtc aggtccgagc cacgacgggc cggagacccc gcccactgca
     1261 gaccagtaga gaccggactg gtctttacag gtctccatgg taactggcgg gacatccaac
     1321 tgtgtggggt tttgagactt gacagccatg tttgtggatc acatgattga aatattaaat
     1381 catgtgataa ctctacagct ctgtggtgtg tttcagtctg atcgtcatgt caccatgttt
     1441 aataattgat tattgatatt ttatttattg tgtaaataag taaatacgga gtaagtgtga
     1501 tgtcacctgg ttgtgttgtg ctgaattaat tttttttttc tttatcattt ttaagttttt
     1561 tggaaaacaa ccccccatca cctctgtgt
//

Home  Molecular Cell Biology     分子細胞生物学研究室ホーム    WEBホーム