DATA List                                                                                       Return to Data Frame

 

1: AB057663. Mus musculus cRAF...[gi:18157433]  
LOCUS       AB057663                2811 bp    mRNA    linear   ROD 12-JAN-2002
DEFINITION  Mus musculus cRAF mRNA for protein kinase raf 1, complete cds.
ACCESSION   AB057663
VERSION     AB057663.2  GI:18157433
KEYWORDS    .
SOURCE      Mus musculus liver cDNA to mRNA.
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus.
REFERENCE   1
  AUTHORS   Gray,T.A., Azama,K., Whitmore,K.L., Min,A., Abe,s. and
            Nicholls,R.D.
  TITLE     A conserved gene antisense to the proto-oncogene c-RAF encodes a
            multi-zinc-finger protein, MAKORIN2
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2811)
  AUTHORS   Doi,M. and Abe,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAR-2001) Shunnosuke Abe, Ehime University Faculty of
            agriculture, Laboratory of Molecular Cell Biology; Tarumi 3-5-7,
            Matsuyama, Ehime 790-8566, Japan (E-mail:abe@mcb.agr.ehime-u.ac.jp,
            Tel:81-899-46-9853, Fax:81-899-46-9853)
COMMENT     On Jan 15, 2002 this sequence version replaced gi:13429989.
FEATURES             Location/Qualifiers
     source          1..2811
                     /organism="Mus musculus"
                     /db_xref="taxon:10090"
                     /tissue_type="liver"
     gene            1..2811
                     /gene="cRAF"
     CDS             197..2143
                     /gene="cRAF"
                     /codon_start=1
                     /product="protein kinase raf 1"
                     /protein_id="BAB39743.2"
                     /db_xref="GI:18157434"
                     /translation="MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASD
                     DGKLTDSSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLL
                     QEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLL
                     NGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTVGDSGVPAPPSFPMRRMR
                     ESVSRMPASSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLHVDSRM
                     IEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRG
                     QRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRN
                     EVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIAR
                     QTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGS
                     VLWMAPEVIRMQDDNPFSFQSDVYSYGIVLYELMAGELPYAHINNRDQIIFMVGRGYA
                     SPDLSRLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPS
                     LHRAAHTEDINACTLTTSPRLPVF"
BASE COUNT      700 a    708 c    722 g    681 t
ORIGIN      
        1 gagaaaccgg tcagggtccc gcctcaaagg cttgcgacct cgcctggggc ttccaaatgg
       61 gtggcccggg atgctcgcga tcgggagcca ggctgccttt tgtgtgaagc gacaacctcc
      121 caggcttttg cagagccggt gcatggatgc agagttggga cacaaacgag gtataagtat
      181 tgtttaaact gcatcaatgg agcacataca gggagcttgg aagacgatca gcaatggctt
      241 tggactcaaa gatgcggtgt ttgatggctc cagctgcatc tcccctacca ttgttcagca
      301 gtttggctat cagcgccggg cctcagatga tggcaagctc acggattctt ctaagacaag
      361 caatactatc cgggttttct tgccgaataa gcaaaggact gtggtcaatg tgcggaatgg
      421 aatgagctta catgactgcc ttatgaaagc tctgaaggtg agaggcctgc agccagagtg
      481 ctgtgcagtg ttcagacttc tccaggaaca caaaggtaag aaagcacgct tagattggaa
      541 caccgatgcc gcctctctga ttggagaaga actgcaagtg gattttttgg atcatgttcc
      601 actcacaact cacaactttg ctcggaaaac gttcctgaag cttgcattct gtgacatctg
      661 tcagaagttc ctgctaaatg gatttcgatg tcagacttgt ggctacaagt ttcatgagca
      721 ctgtagcacc aaagtaccta ctatgtgtgt ggactggagt aatatcagac agctcttgct
      781 gtttccaaat tccactgttg gtgacagtgg agtcccagca ccaccttctt tcccaatgcg
      841 tcggatgcga gaatctgttt cccggatgcc tgctagttcc cagcacagat actctacacc
      901 ccatgccttc actttcaaca cctccagccc ttcctcagaa ggttccctgt cccagaggca
      961 gaggtcaacg tccactccca atgtccacat ggtcagcacc accctgcatg tggacagcag
     1021 gatgattgag gatgcaattc gaagtcacag tgaatcagcc tcaccttcag ccctgtccag
     1081 cagcccaaac aacctgagtc caacaggctg gtcacagccc aaaacccctg tgccagcaca
     1141 aagagagcgg gcaccaggat ctgggaccca ggaaaaaaac aaaattaggc ctcgtgggca
     1201 gagagactcg agttattact gggaaataga agccagtgag gtgatgctgt ctactcggat
     1261 cgggtcaggt tcctttggca ctgtgtacaa gggcaagtgg catggagatg ttgcagtaaa
     1321 gatcctaaag gtggttgacc caactccaga gcaacttcag gccttcagga acgaggtggc
     1381 tgttttgcgc aaaacacggc atgttaacat cctgctgttc atggggtaca tgacaaagga
     1441 caacctggcg attgtgactc agtggtgtga aggcagcagt ctctacaaac acctgcatgt
     1501 ccaggagacc aaattccaga tgttccagct aattgacatt gcccgacaga cagctcaggg
     1561 aatggactat ttgcatgcaa agaacatcat ccacagagac atgaaatcca acaatatatt
     1621 tctccatgaa ggcctcacgg tgaaaattgg agattttggt ttggcaacag tgaagtcacg
     1681 ctggagtggt tctcagcagg ttgaacagcc cactggctct gtgctgtgga tggccccaga
     1741 agtaatccgg atgcaggatg acaacccgtt cagcttccag tccgacgtgt actcgtacgg
     1801 catcgtgctg tacgagctga tggctgggga gcttccctac gcccacatca acaaccgaga
     1861 ccagatcatc ttcatggtag gccgtgggta tgcatcccct gatctcagca ggctctacaa
     1921 gaactgcccc aaggcaatga agaggttggt ggctgactgt gtgaagaaag tcaaagaaga
     1981 gagacctttg tttccccaga tcctgtcttc catcgagctg cttcagcact ctctgccgaa
     2041 aatcaacagg agcgcctctg agccttccct gcatcgggca gctcacactg aggacatcaa
     2101 tgcttgcacg ctgactacat ccccaaggct accagtcttc tagctgatga tgtagctgtt
     2161 cttaggccac caggggacga agaagagtca gcaggcacca ctttctgttt ccttgggggc
     2221 agaatgcatg tttttggaaa agctgctgct gctaaggacc tagactactc acagggcctt
     2281 aacttcatat tgccttcttt tctacccctc ctgccctgga aatggaagct gtccaccaag
     2341 aaagcctgct cagctccaga ggtatacaag tcagctgagt atttgtaggg caagtggcct
     2401 tggagaaggt agggcactcc ggctgctgca gggacatgca attgggaact tggctccttg
     2461 agcctatatg gacagtggtg cagtgccagt tttgcacatg gagtcctggc cacctggggg
     2521 agcctgcttt ggtactacag aactttgtgg acaaactgtg tctaaggtgt cctgtgtgga
     2581 tggctttcca agcgcggtgc tccacctttg gcagcctccc acgtgctgaa tctgtcttcc
     2641 aggagctgcc cctatggggt gggccgcggc ccaaccctat ctgtagccac atccttgtct
     2701 gtaagaaagc caggaataca ggttttctta atgattttgg gttttaattt tgtttttatt
     2761 gagccaatac agttggttcc ttatgttatt ttaataaaat aaattaaatt t
//

Home Molecular Cell Biology      ?????? Return to Data Frame ?????????????    WEB???