DATA List                                                                                       Return to Data Frame

 
AB029826  Homo sapiens MCC-B mRNA for 3-methylcrotonyl-CoA carboxylase biotin-containing subunit, complete cds
LOCUS       AB029826     2528 bp    mRNA            PRI       12-APR-2001
DEFINITION  Homo sapiens MCC-B mRNA for 3-methylcrotonyl-CoA carboxylase
            biotin-containing subunit, complete cds.
ACCESSION   AB029826
VERSION     AB029826.1  GI:9049351
KEYWORDS    MCCase-B.
SOURCE      Homo sapiens cDNA to mRNA.
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo.
REFERENCE   1  (sites)
  AUTHORS   Obata,K., Fukuda,T., Morishita,R., Abe,S., Asakawa,S.,
            Yamaguchi,S., Yoshino,M., Ihara,K., Murayama,K., Shigemoto,K.,
            Shimizu,N. and Kondo,I.
  TITLE     Human Biotin-Containing Subunit of 3-Methylcrotonyl-CoA Carboxylase
            Gene (MCCA): cDNA Sequence, Genomic Organization, Localization to
            Chromosomal Band 3q27, and Expression
  JOURNAL   Genomics 72, 145-152 (2001)
REFERENCE   2  (bases 1 to 2528)
  AUTHORS   Obata,K., Kondo,I. and Fukuda,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUL-1999) Keiko Obata, Ehime University, School of
            Medicine, Department of Hygiene; Shitsukawa, Shigenobu, Ehime
            791-0295, Japan (E-mail:obata@m.ehime-u.ac.jp, Tel:+81-89-960-5278,
            Fax:+81-89-960-5279)
COMMENT     Sequence updated (06-Apr-2000).
FEATURES             Location/Qualifiers
     source          1..2528
                     /organism="Homo sapiens"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3q27"
     gene            133..2310
                     /gene="MCC-B"
     CDS             133..2310
                     /gene="MCC-B"
                     /codon_start=1
                     /product="3-methylcrotonyl-CoA carboxylase
                     biotin-containing subunit"
                     /protein_id="BAA99407.1"
                     /db_xref="GI:9049352"
                     /translation="MAAASAVSVLLVAAERNRWHRLPSLLLPPRTWVWRQRTMKYTTA
                     TGRNITKVLIANRGEIACRVMRTAKKLGVQTVAVYSEADRNSMHVDMADEAYSIGPAP
                     SQQSYLSMEKIIQVAKTSAAQAIHPGCGFLSENMEFAELCKQEGIIFIGPPPSAIRDM
                     GIKSTSKSIMAAAGVPVVEGYHGEDQSDQCLKEHARRIGYPVMIKAVRGGGGKGMRIV
                     RSEQEFQEQLESARREAKKSFNDDAMLIEKFVDTPRHVEVQVFGDHHGNAVYLFERDC
                     SVQRRHQKIIEEAPAPGIKSEVRKKLGEAAVRAAKAVNYVGAGTVEFIMDSKHNFCFM
                     EMNTRLQVEHPVTEMITGTDLVEWQLRIAAGEKIPLSQEEITLQGHAFEARIYAEDPS
                     NNFMPVAGPLVHLSTPRADPSTRIETGVRQGDEVSVHYDPMIAKLVVWAADRQAALTK
                     LRYSLRQYNIVGLHTNIDFLLNLSGHPEFEAGNVHTDFIPQHHKQLLLSRKAAAKESL
                     CQAALGLILKEKAMTDTFTLQAHDQFSPFSSSSGRRLNISYTRNMTLKDGKNNVAIAV
                     TYNHDGSYSMQIEDKTFQVLGNLYSEGDCTYLKCSVNGVASKAKLIILENTIYLFSKE
                     GSIEIDIPVPKYLSSVSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKM
                     EHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESDKRESE"
BASE COUNT      733 a    537 c    656 g    602 t
ORIGIN      
        1 cccaaaggta ggctcaggct ccgacggtgg cccgcggggg tcacgaggct tcgtagtgga
       61 ggaacgggtt tggcgtgtgg gacgcagctg cctctgtact ggggagtcac ggagtggccg
      121 ggctccaggg acatggcggc ggcctctgcg gtgtcggtgc tgctggtggc ggcggagagg
      181 aaccggtggc atcgtctccc gagcctgctc ctgccgccga ggacatgggt gtggaggcaa
      241 agaaccatga agtacacaac agccacagga agaaacatta ccaaggtcct cattgcaaac
      301 agaggagaaa ttgcctgcag ggtgatgcgc acagccaaaa aactgggtgt acagactgtg
      361 gcggtttata gtgaggctga cagaaattcc atgcatgtag atatggcaga tgaagcatat
      421 tccatcggcc ccgctccctc ccagcagagc tacctatcta tggagaaaat cattcaagtg
      481 gccaagacct ctgctgcaca ggctatccat ccaggatgcg gttttctttc agaaaacatg
      541 gaatttgctg aactttgtaa gcaagaagga attattttta taggccctcc tccatctgca
      601 attagagaca tgggtataaa gagcacatcc aaatccataa tggctgctgc tggagtacct
      661 gttgtggagg gttatcatgg tgaggaccaa tcagaccagt gcctgaagga acacgccagg
      721 agaattggct atcctgtcat gattaaagcc gtccggggtg gaggaggaaa aggaatgagg
      781 attgttagat cagaacaaga atttcaagaa cagttagagt cagcacggag agaagctaag
      841 aagtctttca atgatgatgc tatgctgatc gagaagtttg tagacacacc gaggcatgta
      901 gaagtccagg tgtttggtga tcaccatggc aatgctgtgt acttgtttga aagagactgt
      961 agtgtgcaga ggcgacatca gaagatcatt gaggaggccc cagcgcctgg tattaaatct
     1021 gaagtaagaa aaaagctggg agaagctgca gtcagagctg ctaaagctgt aaattatgtt
     1081 ggagcaggga ctgtggagtt tattatggac tcaaaacata atttctgttt catggagatg
     1141 aatacaaggc tgcaagtgga acatcctgtt actgagatga tcacaggaac tgacttggtg
     1201 gagtggcagc ttagaattgc agcaggagag aagattcctt tgagccagga agaaataact
     1261 ctgcagggcc atgccttcga agctagaata tatgcagaag atcctagcaa taacttcatg
     1321 cctgtggcag gcccattagt gcacctctct actcctcgag cagacccttc caccaggatt
     1381 gaaactggag tacggcaagg agacgaagtt tccgtgcatt atgaccccat gattgcgaag
     1441 ctggtcgtgt gggcagcaga tcgccaggcg gcattgacaa aactgaggta cagccttcgt
     1501 cagtacaata ttgttggact gcacaccaac attgacttct tactcaacct gtctggccac
     1561 ccagagtttg aagctgggaa cgtgcacact gatttcatcc ctcaacacca caaacagttg
     1621 ttgctcagtc ggaaggctgc agccaaagag tctttatgcc aggcagccct gggtctcatc
     1681 ctcaaggaga aagccatgac cgacactttc actcttcagg cacatgatca attctctcca
     1741 ttttcgtcta gcagtggaag aagactgaat atctcgtata ccagaaacat gactcttaaa
     1801 gatggtaaaa acaatgtagc catagctgta acgtataacc atgatgggtc ttatagcatg
     1861 cagattgaag ataaaacttt ccaagtcctt ggtaatcttt acagcgaggg agactgcact
     1921 tacctgaaat gttctgttaa tggagttgct agtaaagcga agctgattat cctggaaaac
     1981 actatttacc tattttccaa ggaaggaagt attgagattg acattccagt ccccaaatac
     2041 ttatcttctg tgagctcaca agaaactcag ggcggcccct tagctcctat gactggaacc
     2101 attgaaaagg tgtttgtcaa agctggagac aaagtgaaag cgggagattc cctcatggtt
     2161 atgatcgcca tgaagatgga gcataccata aagtctccaa aggatggcac agtaaagaaa
     2221 gtgttctaca gagaaggtgc tcaggccaac agacacactc ctttagtcga gtttgaggag
     2281 gaagaatcag acaaaaggga atcggaataa actccagcaa ggaaatggcc agttaagtag
     2341 tgtcttctct ctccaccaaa aagaggaagt gcctccagct tttctggggg tctcataaag
     2401 agcagtttta ctaaatgatt gtatgcttat gctgaacacc tttcatattg gagaatcatg
     2461 catttgggtc actaattatc tcaaaatatt tcatactaat aaagttgaat tattttttat
     2521 tggaagcc
//


Home  Molecular Cell Biology      データリスト  Return to Data Frame 分子細胞生物学研究室ホーム    WEBホーム