DATA List                                                                                        Return to Data Frame

LOCUS       AB003549     1978 bp    mRNA            PLN       05-FEB-1999
DEFINITION  Pisum sativum mRNA for F1 ATPase, complete cds.
ACCESSION   AB003549
NID         g2204063
VERSION     AB003549.1  GI:2204063
KEYWORDS    F1 ATPase.
SOURCE      Pisum sativum (strain:Alaska) seedling internode cDNA to mRNA,
            clone_lib:pea internode cDNA library clone:pOK2003.
  ORGANISM  Pisum sativum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons;
            Rosidae; Fabales; Fabaceae; Papilionoideae; Pisum.
REFERENCE   1  (bases 1 to 1978)
  AUTHORS   Abe,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAY-1997) to the DDBJ/EMBL/GenBank databases.
            Shunnosuke Abe, University of Ehime, Department of Biological
            Resources; 3-5-7 Tarumi, Matsuyama, Ehime 790-8566, Japan
            (E-mail:abe@dpc.ehime-u.ac.jp, Tel:81-899-46-9853,
            Fax:81-899-46-9853)
REFERENCE   2  (sites)
  AUTHORS   Okamoto,T., Shibata,K. and Abe,S.
  TITLE     None
  JOURNAL   Unpublished (1997)
COMMENT     On Jun 19, 1997 this sequence version replaced gi:2116557.
            Sequence updated (18-Jun-1997).
FEATURES             Location/Qualifiers
     source          1..1978
                     /organism="Pisum sativum"
                     /strain="Alaska"
                     /db_xref="taxon:3888"
                     /clone="pOK2003"
                     /clone_lib="pea internode cDNA library"
                     /dev_stage="seedling"
                     /tissue_type="internode"
     gene            20..1705
                     /gene="F1 ATPase"
     CDS             20..1705
                     /gene="F1 ATPase"
                     /codon_start=1
                     /product="F1 ATPase"
                     /protein_id="BAA20135.1"
                     /db_xref="PID:d1020951"
                     /db_xref="PID:g2116558"
                     /db_xref="GI:2116558"
                     /translation="MASRRLVSSLIRSSLRRSSSKPSISASTSRLTSQSRASPCGYLL
                     NRVAHYATSAAAAALPPSPPPAKKEGPGGGKITDEFTGKGAIGHVCQVIGAVVDVRFE
                     EGLPPILTSLGLLGSHETRFWTLEVAQFGRGRVRTIAMDATEGVVRGWRVLNTGSPIS
                     VPVGRANPWAYHEVIGEPIDEKGELKTEHFLPIHREGPSFVEQATEQEILVTGIKVVD
                     LLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYRE
                     MIESGVIKLGDKQSESKCALVYGQMNGPPGARARVGLTGLTVAEHFRDAEGQDVLLFV
                     DNIFRFTQANSEVSRLLGRIPSAVGYQPTLATDLGGLQERITTPKKGSITPGQAIYVP
                     ADDLTDLAPATTFAHLDATTVLSRTISELGIYPVVDPLDSTSRMLSPLILGEAHYETA
                     RGVQKVLQNYKNLQGIIAILGMDELSEDDKLTVARARKIQRFLSQPFHVAEVFTGGPG
                     KYVDLKENITSFQGVLDGKYDDLSEQSFYMVGGIEEVIAKAEKIAKESAASSS"
BASE COUNT      458 a    433 c    478 g    609 t
ORIGIN      
        1 ctcctttctc tctctgaaga tggcttcacg cagactcgta tcgtctctga ttcgatcttc
       61 tcttcgtcga tcctcatcga aaccctcaat ttccgcctca acttcgaggc tcacttctca
      121 atcccgtgcc tctccttgcg gctatcttct taaccgcgta gcgcattacg ctacttcggc
      181 cgcagctgct gctcttcctc catctccgcc tccagcgaaa aaggagggtc ccggtggtgg
      241 taaaatcacc gatgagttca ccggtaaggg tgcgatcggg catgtttgtc aggttattgg
      301 tgccgtcgtc gatgtcagat tcgaagaggg tttgcctccg atcttgactt ctcttgggct
      361 tttgggctca catgaaacgc ggttttggac gttggaagtt gcgcaatttg ggcgagggcg
      421 tgtcagaact attgctatgg atgctactga aggtgttgtt agagggtggc gtgtgctcaa
      481 cactggatcc cctatcagtg ttcctgtcgg tagggccaac ccctgggcct atcatgaagt
      541 tattggagag cctattgacg agaagggtga attgaaaact gagcattttt tgcccatcca
      601 tagagaaggc ccttcttttg ttgagcaagc aactgaacag gaaattcttg ttactggtat
      661 caaggttgtt gacctgcttg caccatacca aagaggagga aagattgggt tgtttggtgg
      721 tgctggtgtt ggaaagactg tgcttattat ggaacttatc aacaatgttg ctaaggcgca
      781 tggtggtttc tctgtgtttg ctggtgttgg agaacgaact cgagagggta atgacctgta
      841 cagagaaatg attgagagtg gtgtcattaa gctgggtgat aagcagagtg aaagcaaatg
      901 tgctcttgtg tatggccaaa tgaacggacc ccctggtgcc cgtgcgcgtg ttggtcttac
      961 tggacttact gttgctgagc acttccgtga tgctgaaggg caagatgtgc ttctttttgt
     1021 tgacaacatt ttccgtttca ctcaagctaa ctcagaggtg tctcgtttac ttggccgtat
     1081 cccatctgct gttggttacc aaccaacatt ggctactgac ctgggaggtc tccaagaacg
     1141 tattacaacc cccaaaaaag ggtcaattac ccctggccaa gctatctacg tgcctgctga
     1201 cgatttgaca gatctggccc ccgccactac ctttgcacac ttggatgcca caacagtgtt
     1261 gtcacgaacg atctctgagc ttggtatcta tcctgttgtc gacccattgg attctacatc
     1321 tcgtatgctt tccccactta ttttgggtga ggcccactat gaaaccgctc gtggtgtaca
     1381 gaaagtactt caaaactaca agaatcttca aggtatcatt gcaattttgg gaatggatga
     1441 gctcagtgaa gacgataaat tgactgttgc ccgtgcccgt aagattcagc gattcttgag
     1501 ccagcctttc catgttgcag aagtcttcac tggtggccct ggcaaatatg ttgacttgaa
     1561 ggagaacatt actagtttcc agggtgtgtt ggatggcaag tacgatgacc tttcagagca
     1621 gtcattttac atggttggtg gtattgaaga ggtcattgcg aaggcagaga agattgccaa
     1681 ggaatcagct gcatcttcat cttaatctca caaatccctc ccatcatttt gtcttttctt
     1741 tataattgcg aaaatttaat aatttaggaa ctctttcttg caatgccaaa caacaaaaat
     1801 tttccatttt ataattttta taatttgaat ggtcattcct ttcattttga gtgttgttgc
     1861 tgacggtgag atcaaccaaa ttatgtggcc gctttttttc cgttgtgtta tttaataagt
     1921 ggatgatgca acagattgta catttttatt tgttaagaac ttggatgcat ccattgtt
//

Home  Molecular Cell Biology      データリスト  Return to Data Frame 分子細胞生物学研究室ホーム    WEBホーム