LOCUS       AB023621     2216 bp    DNA             PLN       23-JAN-2001
DEFINITION  Pisum sativum gene for apyrase S-type, complete cds.
ACCESSION   AB023621
VERSION     AB023621.1  GI:11596072
KEYWORDS    apyrase S-type.
SOURCE      Pisum sativum (strain:Alaska) Seedling Dark grown stem internode
            DNA.
  ORGANISM  Pisum sativum Eukaryota; Viridiplantae; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; Rosidae; eurosids I; Fabales; Fabaceae; Papilionoideae; Pisum. REFERENCE 1 (sites) AUTHORS Shibata,K., Abe,S. and Davies,E. TITLE Structure of the coding region and mRNA variants of the apyrase gene from pea (Pisum sativum) JOURNAL Acta Physiol. Plant. (2000) In press REFERENCE 2 (bases 1 to 2216) AUTHORS Shibata,K. and Abe,S. TITLE Direct Submission JOURNAL Submitted (12-FEB-1999) Shunnosuke Abe, University of Ehime, Department of Biological Resources; 3-5-7 Tarumi, Matsuyama, Ehime 790-8566, Japan (E-mail:abe@dpc.ehime-u.ac.jp, URL:http://molcellbiology.jp/bunnshi/, Tel:81-899-46-9853, Fax:81-899-46-9853) COMMENT Sequence updated (17-May-1999). FEATURES Location/Qualifiers source 1..2216 /organism="Pisum sativum" /strain="Alaska" /db_xref="taxon:3888" /tissue_type="Dark grown stem internode" /dev_stage="Seedling" exon            <1..284
     CDS             join(45..284,374..502,621..677,774..866,971..1268,
                     1359..1573,1681..1873,1956..2098)
                     /note="ATP diphosphohydrolase (apyrase) S-type"
                     /codon_start=1
                     /product="apyrase S-type"
                     /protein_id="BAB18890.1"
                     /db_xref="GI:11596073"
                     /translation="MEFLIKLITFLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSY
                     AVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPL
                     LEQAEDVVPDDLQPKTPVRLGATAGLRLLNGDASEKILQSVRDMLSNRSTFNVQPDAV
                     SIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKTAKNAPKV
                     ADGDDPYIKKVVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGFNGIYT
                     YSGEEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKNLFA
                     SSSFFYLPEDTGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVASY
                     VCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISALPKFER
                     LMYFV"
     intron          285..373
     exon            374..502
     intron          503..620
     exon            621..677
     intron          678..773
     exon            774..866
     intron          867..970
     exon            971..1268
     intron          1269..1358
     exon            1359..1573
     intron          1574..1680
     exon            1681..1873
     intron          1874..1955
     exon            1956..>2216
BASE COUNT      679 a    373 c    390 g    774 t
ORIGIN      
        1 atactggagc tacctagttt ctctaaattg tttaccctac acaaatggag ttccttatta
       61 aacttatcac ttttctacta ttttctatgc ctgcaatcac ttcctcccaa tacttaggaa
      121 acaacctact caccagtaga aagattttcc taaaacaaga ggaaatttcc tcttacgctg
      181 tcgtattcga tgctggtagc actggtagtc gcattcatgt ttaccatttt aaccagaact
      241 tagatcttct tcatattggc aaaggtgtcg agtattataa taaggtagta aacaatatat
      301 aacatcacta gttgttttca ttgttatcaa atttatacca ctatatattc atattcattc
      361 ttattctttg tagataacac ctggtttgag ttcatacgct aataatccag aacaggctgc
      421 aaaatctctc attccacttt tagagcaagc agaagatgtc gtccccgacg atcttcaacc
      481 caagacaccc gttagacttg gggtgcgttt tttgaaaatt tatattttct ctgtaacaaa
      541 ctcaaataag ttattccaaa cagatcttaa gtaagatgtc gcacgttcct attgacgagt
      601 tttatttgaa aataatgcag gcaactgccg gtttaaggct tttgaatgga gatgcttctg
      661 aaaagatatt gcaatcggta taaccataag tttaattttt taacgatata attcacagtt
      721 agatctaggt ttttcgtcct tcgattgagg ttaattttgt gcttataatt aaggtaaggg
      781 atatgctgag caacagaagt accttcaacg ttcaaccaga cgcagtttct ataattgatg
      841 gaacccaaga aggttcttat ctatgggtat atgactaatc aatccgaaga ttttatagat
      901 attaatctag tttgtcacat atatttatat tcatatgatt ttactatgtt tgtatacctt
      961 gtgttcatag gtgacagtta actatgcatt gggaaattta gggaaaaagt acacaaaaac
     1021 agttggagta atagatcttg gaggtggatc agttcaaatg gcgtatgcag tatcaaagaa
     1081 aactgctaaa aatgctccaa aagttgcaga tggagatgat ccatacatca agaaggttgt
     1141 actcaaggga ataccatatg atctctatgt tcacagttac ttacacttcg gtagagaagc
     1201 atctcgagca gagattttga agctcactcc tcgttctcct aacccttgcc ttttagctgg
     1261 atttaatggt aaacacaaat tagggtttca cttcgaaatt tcgatttgca ttataaatat
     1321 gttaataaca ttagtttttt ttctttttga ttttatagga atctatacat attcaggaga
     1381 agagtttaag gcaactgctt acacttctgg tgcaaacttt aataaatgca aaaacacaat
     1441 tcgtaaggct cttaagttga actatccttg tccatatcag aattgcactt ttggtggaat
     1501 ttggaatggt ggaggaggaa atggacagaa aaaccttttt gcttcttcat ctttctttta
     1561 cctacctgaa gatgtatgta tataatatat catttttcta taattgatga tttcgttgtt
     1621 ttgatttgaa gatgataatc taattcaagt ctttctaatt attatattct ttcattttag
     1681 accggtatgg ttgatgcaag cacacctaat ttcatacttc ggccggtcga tattgagact
     1741 aaagctaaag aagcttgcgc gttaaacttc gaggatgcga aatctactta tccatttctt
     1801 gataagaaaa atgtagcttc atatgtatgc atggatctta tatatcagta tgtgttactc
     1861 gttgatggat ttggtaagtt tgagttatga gagtgtagat gtaataaagt gattattaat
     1921 gttttcatgc aataattgaa tccatttgtt ggcaggtctt gatccattgc aaaagattac
     1981 atcagggaag gaaattgaat accaagatgc tattgtggaa gctgcatggc ctctaggcaa
     2041 tgctgtagaa gccatatcag ctttacctaa atttgagcga ttgatgtatt ttgtttaagt
     2101 ttcttagata tagtaataag atcaactcat caaataaaaa tttcagttga ccctagtttt
     2161 tagagggaga agttttgcct tctctctatc tcattcctcc cttctttctc accatg
//