LOCUS       AB055904     2343 bp    mRNA            PLN       23-FEB-2001
DEFINITION  Pisum sativum mRNA for 110 kDa protein HMP, partial cds.
ACCESSION   AB055904
VERSION     AB055904.1  GI:13111323
KEYWORDS    .
SOURCE      Pisum sativum (variety:Alaska) Seedling Dark grown stem internode
            cDNA to mRNA, clone:pKYHMP6.
  ORGANISM  Pisum sativum
            Eukaryota; Viridiplantae; Embryophyta; Tracheophyta; Spermatophyta;
            Magnoliophyta; eudicotyledons; core eudicots; Rosidae; eurosids I;
            Fabales; Fabaceae; Papilionoideae; Pisum.
REFERENCE   1  (sites)
  AUTHORS   Yagi,K. and Abe,S.
  TITLE     Cloning of cDNA encoding HMP, a 110 kDa protein from Alaska peas
            (Pisum sativum var. Alaska)
  JOURNAL   Published Only in DataBase (2001) In press
REFERENCE   2  (bases 1 to 2343)
  AUTHORS   Shunnosuke,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-FEB-2001) Abe Shunnosuke, Ehime University Faculty of
            agriculture, Lodoratory of Molecular Cell Biology; Tarumi 3-5-7,
            Matsuyama, Ehime 790-8566, Japan (E-mail:abe@mcb.agr.ehime-u.ac.jp,
            Tel:81-899-46-9853, Fax:81-899-46-9853)
FEATURES             Location/Qualifiers
     source          1..2343
                     /organism="Pisum sativum"
                     /variety="Alaska"
                     /db_xref="taxon:3888"
                     /clone="pKYHMP6"
                     /tissue_type="Dark grown stem internode"
                     /dev_stage="Seedling"
     gene            1..2100
                     /gene="HMP"
     misc_feature    <1..222
                     /gene="HMP"
                     /note="Staphylococcal Nuclease Domain SNC (P43270)"
     CDS             <1..2100
                     /gene="HMP"
                     /codon_start=1
                     /product="110 kDa protein HMP"
                     /protein_id="BAB32793.1"
                     /db_xref="GI:13111324"
                     /translation="RDVRIVLEGVDKFSNLIGSVYYPDGESAKDWPLELVENGFAKYV
                     EWSAHMMEEDAKRKLKSAELEAKKSRLRIWTNYVPPVSNSKAIHDQNLTGKLVEVVSG
                     DCVIVADDSIPYGSPQAERRVNLSSIRCPKMGNPRRDEKPAPYAREAKEFLRTRLIGR
                     QVNVQMEYSRKVGPVDAAGAPLGAGDRVMDFGSVFLSSSGKADNDQAPSAAAPASSKL
                     GLNVGELVIGRGFGTVIRHRDFEERSNFYDALLAAESRAISGRKGIHSAKDPPVMHIT
                     DLTTASAKKAKDFMPFLHRSRRVPAVVEYVLSGHRFKLLIPKETCSIAFAFSGVRCPG
                     REEPYSDEAIALMRRRIMQRDVEIEVETVDRTGTFLGPLWESKTNGAVALLEAGLAKL
                     QTTFGSDRIPGSSCLEQPEQSAKSKKLKIWENFVEGEVVPSGANVETKQQEVLKVTVT
                     EVLGGGKFYVQTVGDQKIASIQNQLASLNLKEAPVIGAFNPKKGDIVLCYFRADTSWY
                     RAMVVNTPRGPVESSKDVFEVFYLDYGNQEEVPYSQLRPLDPSVSLAPGLAQLCSLAY
                     IKIPNLEEDFGQEAAEYLSELTLSSGKEFRAMVEERDTTGGKVKGQGTGPVIAVTLVA
                     VDAEISVNAAMLQEGLARMEKRNRWDKSARKQALDNLEMFQGEARTSRRGIWQYGDIQ
                     SDDEDTAPPRKPAGGRR"
     misc_feature    268..798
                     /gene="HMP"
                     /note="Staphylococcal Nuclease Domain SNC (P43270)"
     misc_feature    889..1266
                     /gene="HMP"
                     /note="Staphylococcal Nuclease Domain SNC (P43270)"
     misc_feature    1471..1650
                     /gene="HMP"
                     /note="Tudor Domain for RNA Binding Protein (CAA06786)"
     misc_feature    1654..2034
                     /gene="HMP"
                     /note="Staphylococcal Nuclease Domain SNC (P43270)"
     polyA_signal    2122..2126
BASE COUNT      698 a    415 c    599 g    631 t
ORIGIN      
        1 agagatgttc gcattgttct tgaaggtgtt gataagttca gcaatttgat tggctcagtg
       61 tattatcctg atggtgaatc agcaaaggac tggccattgg agcttgttga aaacggcttt
      121 gctaaatatg ttgaatggag tgcacacatg atggaagaag atgcaaagcg gaagctgaag
      181 tctgcagagc tcgaggctaa gaaaagtagg ttaagaattt ggacaaacta tgtgccaccg
      241 gtttcaaatt ccaaggcaat tcatgaccag aatttaactg gcaagttggt tgaggttgtc
      301 agtggagatt gcgtcattgt tgctgatgat tctattccat atggcagccc acaagctgag
      361 aggcgagtta acctttcaag tattaggtgt ccaaaaatgg gcaatcctcg tcgagatgaa
      421 aaaccagctc cctatgcacg tgaagcaaag gaattcttga gaacacgcct catcggtcgt
      481 caagtgaatg tacaaatgga atattctagg aaggttggtc cagttgatgc agctggagct
      541 ccattgggag ctggtgatag agtaatggat tttggatcag tgttcctatc gtcctctggg
      601 aaagctgaca atgaccaagc cccttcagct gctgctcctg caagcagcaa actggggttg
      661 aatgtcggcg aattggtaat tggtcgtggc tttggaactg tcattagaca tcgtgacttc
      721 gaagagagat ctaacttcta tgatgctctt cttgctgctg aatcacgtgc catttctgga
      781 aggaaaggga tccattctgc caaggatcct ccagtgatgc atataactga cttgaccacg
      841 gcatcggcca agaaagccaa agatttcatg cctttcctgc atagaagtag aagagttcct
      901 gctgtagtgg aatatgtcct cagtggtcac cgtttcaagt tgttgattcc taaagaaact
      961 tgcagtattg cttttgcatt ctctggtgtc agatgtcctg gtcgtgaaga gccatattct
     1021 gatgaagcaa ttgcactgat gaggcggagg ataatgcaaa gagatgttga gattgaggta
     1081 gaaactgtcg atagaactgg aacattcttg ggacccttat gggagtcgaa aacaaacggg
     1141 gcggttgcac tactcgaagc cggtcttgca aaactacaaa ccacctttgg cagtgacagg
     1201 attcccggat cttcgtgtct tgagcagccc gaacaatctg ctaagagtaa aaagctgaaa
     1261 atctgggaga attttgttga aggggaggta gtacccagtg gtgcaaatgt tgaaaccaaa
     1321 cagcaagaag tacttaaggt aactgttaca gaagtcttgg gaggtggtaa attttatgtc
     1381 cagactgttg gagatcaaaa gatagcatcc attcagaacc aactagcttc tttgaacctg
     1441 aaggaagctc ctgtgattgg tgcttttaat cctaagaagg gtgacatagt cctctgttat
     1501 ttccgcgctg atacgtcttg gtatcgggca atggttgtca atacgcctcg aggaccagtt
     1561 gaatcttcta aggatgtgtt tgaagtattc taccttgatt atggaaatca agaagaagta
     1621 ccatacagtc aactgaggcc tcttgatcca tctgtgtcat tagcacccgg ccttgctcaa
     1681 ttgtgtagcc ttgcatacat taagatacca aacttggaag aggattttgg tcaagaagca
     1741 gctgaatact tgagtgaact cactttaagc agtggaaaag aatttagggc catggttgag
     1801 gagagagaca ctaccggagg aaaagtgaaa gggcagggaa ctggaccagt tattgctgta
     1861 actcttgttg ctgtcgatgc tgagatcagt gtcaatgctg ccatgcttca ggaaggactt
     1921 gctaggatgg aaaaaaggaa caggtgggat aaatcagcca gaaagcaggc ccttgataat
     1981 ttggaaatgt tccaaggaga ggcaagaacc agcaggcgtg gaatatggca gtatggagat
     2041 attcagtctg atgacgagga cactgctcct ccacgaaaac ccgctggtgg ccgcagataa
     2101 gtgtaacggg atgaataagt tataaaatat atagacatct tgagagagaa aatgattcaa
     2161 gttatagaca tgagttagag agaaaaagaa gaaaatgccg tgtatttcct ttgtaagttt
     2221 tgttttgttt ttgttttaac ttttattgtt agatttggct gaacaatttt ttccatagat
     2281 gtcataataa ggtacatgcg gcagggttct tttttaaaaa aaaaaaaaaa aaaaaaaaaa
     2341 aaa
//