-----[ AB003549 ]-----
LOCUS AB003549 1978 bp mRNA PLN 18-JUN-1997
DEFINITION Pea mRNA for F1 ATPase, complete cds.
ACCESSION AB003549
NID g2204063
KEYWORDS F1 ATPase.
SOURCE Pisum sativum (strain:Alaska) seedling internode cDNA to mRNA,
clone_lib:pea internode cDNA library clone:pOK2003.
ORGANISM Pisum sativum
Eukaryotae; mitochondrial eukaryotes; Viridiplantae;
Charophyta/Embryophyta group; Embryophyta; vascular plants; seed
plants; Magnoliophyta; Magnoliopsida; Rutanae; Sapindales;
Fabaceae; Papilionoideae; Pisum.
REFERENCE 1 (bases 1 to 1978)
AUTHORS Abe,S.
TITLE Direct Submission
JOURNAL Submitted (02-MAY-1997) to the DDBJ/EMBL/GenBank databases.
Shunnosuke Abe, University of Ehime, Department of Biological
Resources; 3-5-7 Tarumi, Matsuyama, Ehime 790, Japan
(E-mail:abe@dpc.ehime-u.ac.jp, Tel:0899-46-9853, Fax:0899-46-9853)
REFERENCE 2 (sites)
AUTHORS Okamoto,T., Shibata,K. and Abe,S.
TITLE None
JOURNAL Unpublished (1997)
COMMENT Sequence updated (18-Jun-1997).
FEATURES Location/Qualifiers
source 1..1978
/organism="Pisum sativum"
/strain="Alaska"
/clone="pOK2003"
/clone_lib="pea internode cDNA library"
/dev_stage="seedling"
/tissue_type="internode"
gene 20..1705
/gene="F1 ATPase"
CDS 20..1705
/gene="F1 ATPase"
/codon_start=1
/product="F1 ATPase"
/db_xref="PID:d1020951"
/db_xref="PID:g2116558"
/translation="MASRRLVSSLIRSSLRRSSSKPSISASTSRLTSQSRASPCGYLL
NRVAHYATSAAAAALPPSPPPAKKEGPGGGKITDEFTGKGAIGHVCQVIGAVVDVRFE
EGLPPILTSLGLLGSHETRFWTLEVAQFGRGRVRTIAMDATEGVVRGWRVLNTGSPIS
VPVGRANPWAYHEVIGEPIDEKGELKTEHFLPIHREGPSFVEQATEQEILVTGIKVVD
LLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYRE
MIESGVIKLGDKQSESKCALVYGQMNGPPGARARVGLTGLTVAEHFRDAEGQDVLLFV
DNIFRFTQANSEVSRLLGRIPSAVGYQPTLATDLGGLQERITTPKKGSITPGQAIYVP
ADDLTDLAPATTFAHLDATTVLSRTISELGIYPVVDPLDSTSRMLSPLILGEAHYETA
RGVQKVLQNYKNLQGIIAILGMDELSEDDKLTVARARKIQRFLSQPFHVAEVFTGGPG
KYVDLKENITSFQGVLDGKYDDLSEQSFYMVGGIEEVIAKAEKIAKESAASSS"

BASE COUNT 458 a 433 c 478 g 609 t

ORIGIN

1 ctcctttctc tctctgaaga tggcttcacg cagactcgta tcgtctctga ttcgatcttc
61 tcttcgtcga tcctcatcga aaccctcaat ttccgcctca acttcgaggc tcacttctca
121 atcccgtgcc tctccttgcg gctatcttct taaccgcgta gcgcattacg ctacttcggc
181 cgcagctgct gctcttcctc catctccgcc tccagcgaaa aaggagggtc ccggtggtgg
241 taaaatcacc gatgagttca ccggtaaggg tgcgatcggg catgtttgtc aggttattgg
301 tgccgtcgtc gatgtcagat tcgaagaggg tttgcctccg atcttgactt ctcttgggct
361 tttgggctca catgaaacgc ggttttggac gttggaagtt gcgcaatttg ggcgagggcg
421 tgtcagaact attgctatgg atgctactga aggtgttgtt agagggtggc gtgtgctcaa
481 cactggatcc cctatcagtg ttcctgtcgg tagggccaac ccctgggcct atcatgaagt
541 tattggagag cctattgacg agaagggtga attgaaaact gagcattttt tgcccatcca
601 tagagaaggc ccttcttttg ttgagcaagc aactgaacag gaaattcttg ttactggtat
661 caaggttgtt gacctgcttg caccatacca aagaggagga aagattgggt tgtttggtgg
721 tgctggtgtt ggaaagactg tgcttattat ggaacttatc aacaatgttg ctaaggcgca
781 tggtggtttc tctgtgtttg ctggtgttgg agaacgaact cgagagggta atgacctgta
841 cagagaaatg attgagagtg gtgtcattaa gctgggtgat aagcagagtg aaagcaaatg
901 tgctcttgtg tatggccaaa tgaacggacc ccctggtgcc cgtgcgcgtg ttggtcttac
961 tggacttact gttgctgagc acttccgtga tgctgaaggg caagatgtgc ttctttttgt
1021 tgacaacatt ttccgtttca ctcaagctaa ctcagaggtg tctcgtttac ttggccgtat
1081 cccatctgct gttggttacc aaccaacatt ggctactgac ctgggaggtc tccaagaacg
1141 tattacaacc cccaaaaaag ggtcaattac ccctggccaa gctatctacg tgcctgctga
1201 cgatttgaca gatctggccc ccgccactac ctttgcacac ttggatgcca caacagtgtt
1261 gtcacgaacg atctctgagc ttggtatcta tcctgttgtc gacccattgg attctacatc
1321 tcgtatgctt tccccactta ttttgggtga ggcccactat gaaaccgctc gtggtgtaca
1381 gaaagtactt caaaactaca agaatcttca aggtatcatt gcaattttgg gaatggatga
1441 gctcagtgaa gacgataaat tgactgttgc ccgtgcccgt aagattcagc gattcttgag
1501 ccagcctttc catgttgcag aagtcttcac tggtggccct ggcaaatatg ttgacttgaa
1561 ggagaacatt actagtttcc agggtgtgtt ggatggcaag tacgatgacc tttcagagca
1621 gtcattttac atggttggtg gtattgaaga ggtcattgcg aaggcagaga agattgccaa
1681 ggaatcagct gcatcttcat cttaatctca caaatccctc ccatcatttt gtcttttctt
1741 tataattgcg aaaatttaat aatttaggaa ctctttcttg caatgccaaa caacaaaaat
1801 tttccatttt ataattttta taatttgaat ggtcattcct ttcattttga gtgttgttgc
1861 tgacggtgag atcaaccaaa ttatgtggcc gctttttttc cgttgtgtta tttaataagt
1921 ggatgatgca acagattgta catttttatt tgttaagaac ttggatgcat ccattgtt
//

//